SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014462 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014462
Domain Number 1 Region: 70-231
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.34e-40
Family Eukaryotic proteases 0.00044
Further Details:      
 
Domain Number 2 Region: 11-45
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000918
Family Kringle modules 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014462   Gene: ENSOARG00000013494   Transcript: ENSOART00000014675
Sequence length 328
Comment pep:known_by_projection chromosome:Oar_v3.1:6:114821324:114825082:1 gene:ENSOARG00000013494 transcript:ENSOART00000014675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPTHLSLSTRNPDKDERPWCYVVKDSALSWEYCRLAACESLARIQPPPTEALLTLSGPE
AAGPAGRQTCGKRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIGNNFCAGSLVHTCWVVS
AAHCFSNSPPRESVSVVLGQHFFNRTTDVTQTFGIEKYIPYPLYSVFNPSDHDLVLIRLE
KKGERCAVRSQFVQPICLPEPSSPFPAGHKCQIAGWGHQDERGLRRATGLREERRGLPVR
HHQLGRRLWEAQQAWRLHPRGQLRGLDQRPDSPPQATHESLLSPPLPRGLVSCSSLLAAN
KDVSKTPHTHTLPAPLPKPPSPAFPPRP
Download sequence
Identical sequences W5PVH9
ENSOARP00000014462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]