SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014730 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014730
Domain Number 1 Region: 145-395
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.22e-72
Family Extended AAA-ATPase domain 0.00000164
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000014730
Domain Number - Region: 46-75
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.000824
Family RILP dimerisation region 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014730   Gene: ENSOARG00000013737   Transcript: ENSOART00000014948
Sequence length 412
Comment pep:known_by_projection chromosome:Oar_v3.1:11:47499794:47504262:1 gene:ENSOARG00000013737 transcript:ENSOART00000014948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRGRGKMALDGPEQMELEEGKTGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNA
KVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRV
ALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPEL
FEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVREL
FVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMA
TNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGA
SGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
Download sequence
Identical sequences W5PW97
ENSOARP00000014730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]