SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015035 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015035
Domain Number 1 Region: 47-193
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-44
Family Dual specificity phosphatase-like 0.000000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015035   Gene: ENSOARG00000014009   Transcript: ENSOART00000015255
Sequence length 197
Comment pep:known_by_projection chromosome:Oar_v3.1:3:104100669:104102202:1 gene:ENSOARG00000014009 transcript:ENSOART00000015255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFPAHRVLVLPAGGFDRFQACCPDLCSESPVPAMAPDNDNGRSDSRAPSYDQGGPVEIL
PYLYLGSCSHSSDLQGLRACGITAVLNVSASCPNHFEGLLRYKSIPVEDNQMVEISAWFP
EAIGFIDSVKNSGGRVLVHCQAGISRSATICLAYLIQSRRVRLDEAFDFVKQRRGVISPN
FSFMGQLLQFETQVLCH
Download sequence
Identical sequences W5PX51
ENSOARP00000015035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]