SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015342 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015342
Domain Number 1 Region: 217-339
Classification Level Classification E-value
Superfamily ALDH-like 9.95e-33
Family ALDH-like 0.00000601
Further Details:      
 
Domain Number 2 Region: 3-79
Classification Level Classification E-value
Superfamily ALDH-like 0.00000000000209
Family ALDH-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015342   Gene: ENSOARG00000014292   Transcript: ENSOART00000015566
Sequence length 369
Comment pep:known_by_projection chromosome:Oar_v3.1:21:44827945:44839141:1 gene:ENSOARG00000014292 transcript:ENSOART00000015566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAFEAELSEISISQNEINLALRNLRAWMKDEKVSKNLATQLDSAFIRKEPFGLVLILSPW
NYPLNLSLGPLVGALAAGERDPLPSRFGAGTAPLLAELFSSPGEGVRWAPALQVCEDEWR
WGVATHGPALSPARLTVWDLGPQTLGSKIGSPSDCETKGWGAPRGHFPGAAGREPSLGHP
GPWALTARGPAHQRPTRLRPRPPEGPAPGLSRPLSLAAPTVLVDVQETDPVMQEEIFGPI
LPIVNVRSLGQAIDFINRREKPLALYAFSNNSQVVKRVLAQTSSGGFCGNDGFMHLTLAS
LPFGGVGSSGMGNYHGKFSFDTFSHHRACLLRPPGLEKIYAIRYPPHTPRNLRVLLMALE
TRSCSCTLL
Download sequence
Identical sequences W5PY08
ENSOARP00000015342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]