SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015363 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015363
Domain Number 1 Region: 375-489,608-748
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.85e-65
Family Phosphate binding protein-like 0.00000000119
Further Details:      
 
Domain Number 2 Region: 2-355
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.76e-62
Family L-arabinose binding protein-like 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000015363
Domain Number - Region: 458-603
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000863
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015363   Gene: ENSOARG00000014313   Transcript: ENSOART00000015588
Sequence length 878
Comment pep:known_by_projection chromosome:Oar_v3.1:1:124554929:124725438:1 gene:ENSOARG00000014313 transcript:ENSOART00000015588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNTTLTYDIQKINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQSICNALEVPHI
QTRWKHPSVDNRDLFYINLYPDYAAISRAVLDLVLYYNWKTVTVVYEDSTGLIRLQELIK
APSRYNIKIKIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHETAAEILKQILFMGMMTE
YYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSAIIEKWSMERLQAPPRPETG
LLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEAQWDG
LTGRITFNKTDGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTD
GNKDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILG
FIYDVKLVADGKYGAQNDKGEWNGMVKELIDHKADLAVAPLTITYVREKVIDFSKPFMTL
GISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCN
PDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLA
AFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTA
LVKNSDEGIHRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRD
KITIAILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIGGIFIVLAAGLVLSVF
VAIGEFIYKSRKNNDIEQKGKSSRIRFYFRNKVRFHGRKKQSLGVEKCLSFNAIMEELGI
SLKNQKKLKKKSRTKGKSSFTSILTCHQRRTQRKETMA
Download sequence
Identical sequences W5PY29
ENSOARP00000015363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]