SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015580 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015580
Domain Number 1 Region: 112-205
Classification Level Classification E-value
Superfamily Acid proteases 5.28e-26
Family Retroviral protease (retropepsin) 0.0011
Further Details:      
 
Domain Number 2 Region: 10-97
Classification Level Classification E-value
Superfamily dUTPase-like 1.57e-17
Family dUTPase-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015580   Gene: ENSOARG00000014527   Transcript: ENSOART00000015810
Sequence length 205
Comment pep:novel chromosome:Oar_v3.1:19:2540231:2540860:1 gene:ENSOARG00000014527 transcript:ENSOART00000015810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLYPQAVPSRIPTRLFGSLPPQTFGLLLGQSSLTSKGITVHPGVIDSDYKREIQTMMLSQ
ILWQFKKGDKTAQLHFLPYISINSSNELRMGGFGSTDQKQSFWTTLVSEFAQPTINIKIN
GKRFSGLLDTGSDITIISKHSWPKSWPVQIAGISQTKVQEVYQSTQIYPCEEPEGQPATL
RPSVIDAPLNLIGREILMQWKTQIY
Download sequence
Identical sequences W5PYP5
ENSOARP00000015580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]