SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015588 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015588
Domain Number 1 Region: 353-529,564-730
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.24e-84
Family YicI catalytic domain-like 0.00028
Further Details:      
 
Domain Number 2 Region: 1221-1420,1465-1626
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.69e-73
Family YicI catalytic domain-like 0.00035
Further Details:      
 
Domain Number 3 Region: 974-1218
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.95e-43
Family YicI N-terminal domain-like 0.0063
Further Details:      
 
Domain Number 4 Region: 103-352
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.77e-31
Family YicI N-terminal domain-like 0.022
Further Details:      
 
Domain Number 5 Region: 1629-1709
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.88e-19
Family Putative glucosidase YicI, domain 3 0.0075
Further Details:      
 
Domain Number 6 Region: 733-813
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.15e-16
Family Putative glucosidase YicI, domain 3 0.021
Further Details:      
 
Domain Number 7 Region: 944-996
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000916
Family Trefoil 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015588   Gene: ENSOARG00000014509   Transcript: ENSOART00000015819
Sequence length 1853
Comment pep:known_by_projection chromosome:Oar_v3.1:4:104976784:105059969:1 gene:ENSOARG00000014509 transcript:ENSOART00000015819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKKLKKFTTLELMLSILLLVVFIITIPIFVLSARDSLESQARGKNYSLFPLFSAMIIL
DPGTTVSPDPGTSTTPGSAECPVVNDSERINCIPDQSPTKATCDQRGCCWSPQGTISKPW
CYYSKNHGYRVGGDLMNTNAGFTAQLERLSSPSLFGNNVNNVLLTAEYQTSNRFHFKLTD
QNQNRYEVPHEHVQPFTGNAASSLTYKVEVSKQPFGIKVIRTSNNRVLPGTGLCPFSFSS
FQLTFTNHQLTRFVSKNVWGKQEKTKTQKKQDRCWFRAGPLYAVQETPHQDGTNLYGAQT
FFLCLEDASGLSFGVFLLNSNAMEVFLQPTPAITYRTIGGILDFYVFLGSTPEQVVQEYL
ELIGRPALPSYWALGFHLSRYDYGTLENMKEVVERNRAAQLPYDVQHADIDYMDARKDFT
YDPVAFKGFPEFVKELHNNGQKLVIIVDPAISNNSSLSNPYGPYDRGSDMKIWVNTSDGV
TPLIGEVWPGKTVFPDYTNPKCTAWWTNEFELFHSQVEFDGIWIDMNEVANFVDGSVSGC
STSNLNYPPFTPKILDGYLFSKSICMDAVQHWGQQYDVHNLYGYSMAIATSETVKTVFPN
KRSLILTRSTFAGSGKFAAHWLGDNAATWNDLRWSIPGILEFNLFGIPMVGADICGFILD
TSEELCRRWMQLGAFYPFSRNHNGQGYKAQDPASFGADSLLLNSSRHYLTVRYTLLPYLY
TLFYRAHSRGDTVARPLLHEFYQDSNTWDVHQQFLWGPGLLITPVLDEGAEKVTAYMPDA
VWYDYETGVQERWRKQKVEMELPGDKIGLHLRGGYIFPTQQPATTTVASRRNPLGLIIAL
DENKEAKGELFWDDGETKDTVANNLYLLCEFSVTQNRLEVKILQSTYTDPNNLAFKEIKI
LGTQELKNVAVKQNGVPVQVSPNVTYDSNLQVALITGIDLVLGGTYTVEWDVKIRDEEKI
DCYPDQTGVSAENCTARGCVWEESSSRVVPFCYFVSDLYSVSDVQYDSHGASAVISLKTS
QYAHSFPSVPVNSLRLTVTYHKDYMLQFKIYDPSNNRYEVPVPLNIPNVPSGTPESQLYA
VLIKENPFGIEIRRKSTGTVIWDSQLLGFTFNDMFIRISTRLPSRYLYGFGETEHTAFRR
DLGWNTWGMFSRDQPPGYKKNCYGVHPYYMAMEEDGSAHGVLLLNSNAMDVTFQPLPALT
YRTTGGILDFYVVLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYD
AMVAAQIPYDVQYSDIDYMERQLDFTLDVEFEGFPALITRMKADGMRVIIILDPAISGNE
TKPYLPFTRGVEDDVFIKDPSDGSIVWGKVWPDFPDVVINSSLDWDSQVEKYRAFVAFPD
FFRNSTIAWWKRELKELYTNPREPEKSLKFDGLWIDMNEPASFVNGAVLPGCKNATLNNP
PYMPHLESRDLGLSSKTLCMESQQVLPDGSPVRHYDVHSLYGWAQTRPTYEAVQEVTGQR
GIVITRSTFPSSGRWGGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAE
YEMCARWMQLGAFYPFARNHNTIGTRRQDPVSWNSTFVTISKSVLETRYTLLPYFYTLMH
KASTEGSTVVRPLLHEFVSDRVTWTIDSQFLLGPAFLVSPVLEANARDVTAYFPKARWYD
YYTGVDIQSMGEWKSLPAPLDHINLHVRGGYVLPWQEPAQNTHLSRQKFFGFKVALDDEG
TAEGWLFWDDGQSIDTYEKGQYYLAHFSVSQNTMQSHIIFNKYISDTNPLRLGYFEVWGV
GSDSISSVSISVSGVVITPTFSYNSTTQVLNIDVTSRNISLHNFTSLTWRSTL
Download sequence
Identical sequences W5PYQ3
ENSOARP00000015588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]