SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016319 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016319
Domain Number 1 Region: 21-182
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 6.85e-36
Family Glyoxalase I (lactoylglutathione lyase) 0.0000000727
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016319   Gene: ENSOARG00000015212   Transcript: ENSOART00000016554
Sequence length 188
Comment pep:known_by_projection chromosome:Oar_v3.1:20:12545898:12573190:-1 gene:ENSOARG00000015212 transcript:ENSOART00000016554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSAAMAEPQPASGGLTDEAALSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRILGMT
LLQKLDFPTMKFSLYFLAYEDKNDIPKDKDEKVAWVFSRKATLELTHNWGTEDDETQSYH
SGNSDPRGFGHIGIAVPDVHGACKRFEELGVRFVKKPNDGKMKGLAFIQDPDGYWIEILN
PNTMITII
Download sequence
Identical sequences W5Q0T3
ENSOARP00000016319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]