SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016435 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016435
Domain Number 1 Region: 98-142
Classification Level Classification E-value
Superfamily LysM domain 0.0000000109
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016435   Gene: ENSOARG00000015316   Transcript: ENSOART00000016670
Sequence length 872
Comment pep:known_by_projection chromosome:Oar_v3.1:9:70509441:70953892:-1 gene:ENSOARG00000015316 transcript:ENSOART00000016670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVTNLPWLKKKSQSVDITAPGFNPLAGAGKQMPQASKPPAPKTPIIEEEQNNAANSQKH
PSRRSELKRFYTIDTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPN
ELVQLNKLFSRAVVTGQVLYVPDPDYVSSVESSPSLSPISPLSPTSSEAEFEKTTTPDVV
HPKEATPSSAFTAIRPARVVSSTSEEEEAFTEKFLKINCRYITSGKGTVSGVLLVTPNNI
MFDPHKTDPLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIEIDQLSGRDFCH
LKKVTRSNTDELDSRIRDAANDSASTAPRSTEESLSEDVFTESELSPIREELISSDELRH
DKSSGASSESVQTITQSGVECLTVISEAASTPDHLKSGSGHTANEVGTLSLKTGLNNLEM
ATKEGDQAADNLQKISGLKEQSTGIKKDNQDFPLNENSLHQEEVEKESMPCGEAIEFKQK
QVVNKGKQGREQNQDSETEVEELRKLWKSHSMQQTKLQRENIQQVSQEEIKHKVATADIE
GSALLKEKRRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTDH
LYAFFIQWSPETYAEDTGEYTKEPGFIVVKKIEESETNEDSTNEAAAREWEVVSVAEYHR
RIDALNTEELRTLCRRLQITTREDVNSKQTTPVRADLESESFRPNLSDPSDLLLPDQIEK
LTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEP
FKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLY
HGRSHSCKTFGNHTLSKKEDFFIQDIEIWAFE
Download sequence
Identical sequences W5Q149
ENSOARP00000016435 XP_004011840.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]