SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016555 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016555
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.06e-72
Family Alanine racemase-like, N-terminal domain 0.000000000654
Further Details:      
 
Domain Number 2 Region: 267-417
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 4.4e-49
Family Eukaryotic ODC-like 0.000000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016555   Gene: ENSOARG00000015431   Transcript: ENSOART00000016791
Sequence length 461
Comment pep:known chromosome:Oar_v3.1:3:19476350:19480752:-1 gene:ENSOARG00000015431 transcript:ENSOART00000016791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSFSNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSRTIVKTLAAIGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSRLL
LERAKELDIDVIGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFNMYLLDIGGGFPG
SEDVKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKLVLKEQ
TGSDDEEESSERTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPTWQLMQQI
RAQDFPPGVEEPDVSPLPVSCARESGMKRHSAACASTRINV
Download sequence
Identical sequences W5Q1G7
ENSOARP00000016555 XP_011975251.1.54773 XP_017911149.1.57651 XP_017911150.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]