SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016569 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016569
Domain Number 1 Region: 139-275
Classification Level Classification E-value
Superfamily Acid proteases 3.87e-45
Family Retroviral protease (retropepsin) 0.0000793
Further Details:      
 
Domain Number 2 Region: 17-149
Classification Level Classification E-value
Superfamily dUTPase-like 1.96e-33
Family dUTPase-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016569   Gene: ENSOARG00000015448   Transcript: ENSOART00000016805
Sequence length 289
Comment pep:novel chromosome:Oar_v3.1:1:240087445:240088314:1 gene:ENSOARG00000015448 transcript:ENSOART00000016805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWGNTAGSKRTIADLCRATRGSAGLDLCATSYTVLTPEMGVQTLATGVFGPLPPGTAGL
LLGRSSASLKGILIHPGVIDSDYTGEIKILASAPNKIIVINAGQRIAQLLLVPLVIQGKT
INRDRQDKGFGSSDAYWVQNVTEARPELELRINGKLFRGVLDTGADISVISDKYWPTTWP
KQMAISTLQGIGQTTNPEQSSSLLTWTDKDGHTGQFKPYILPYLPVNLWGRDILSKMGVY
LYSPSPTVTDLMLDQGLLPNQGLGKQHQGIILPLDLKSNQDRKGLGCFP
Download sequence
Identical sequences Q9TTD4
ENSOARP00000016569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]