SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016663 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016663
Domain Number 1 Region: 384-546,588-757
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.32e-44
Family WD40-repeat 0.0034
Further Details:      
 
Domain Number 2 Region: 723-870
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000769
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 
Domain Number 3 Region: 259-439
Classification Level Classification E-value
Superfamily Peptidase/esterase 'gauge' domain 0.000000000968
Family Acylamino-acid-releasing enzyme, N-terminal donain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016663   Gene: ENSOARG00000015538   Transcript: ENSOART00000016901
Sequence length 897
Comment pep:known_by_projection chromosome:Oar_v3.1:21:40333115:40343336:-1 gene:ENSOARG00000015538 transcript:ENSOART00000016901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEGGGPSEGPAQEALQSLSRRLQVQEKEMELVKAALAEALRLLRLQAPPTSLQDPGTLGP
PRDSSPAAPPGLPPTCSPSLVSRGTQTEAEMEVEASPGPPGLSNGPPAPPGGSEEPSGTQ
SEGGGSSSSGTGSPGPPGILRLAQPPQRIDAPRRNSSSSSPSERPRQKLSRKAASSANLL
LRSGSTESRGGKDSLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYIPSGIRSVEELPS
GPPPETLSLDWVYPYGYRGRDSRSNLFVLRSGEVVYFIACVVVLYRPGGGPGGPGGGGQR
HYRGHTDCVRCLAVHPDGVRVASGQTAGVDKDGKPLQPVVHVWDSETLLKLQEIGLGAFE
RGVGALAFSVADQGAFLCVVDDSNEHMLSVWDCSRGTKLAEIKSTNDSVLAVGFNPRDSS
SIVTSGKSHVHFWNWNGGTGVPGNGMLTRKQGVFGKYKKPKFISCFVFLPDGDILTGDSE
GNILTWGRSLSDSRTPGRGGAKETYGIVAQVHAHEGSIFALCLRRDGTVLSGGGRDRRLV
QWGPGLVALQEAEIPEHFGAVRAIAEGPGSELLVGTTKNALLRGDLAQGFSPVIQGHTDE
LWGLCTHPFQNRFLTCGHDRQLCLWDGEGHALAWSIDLKETGLCADFHPSGAVVAVGLNT
GRWLVLDTETREIVSDITDGNEQLSVVRYSPDGLYLAIGSHDNMIYIYSVSSDGAKSSRF
GRCVGHSSFITHLDWSKDGNFIMSNSGDYEILYWDVAGGCKLLRNRYESRDREWATYTCV
LGFHVYGVWPDGSDGTDINSLCRSHNERVVAVADDFCKVHLFQYPCAHAKAPSLVYGGHG
SHVTSVRFTHAGSHLISLGGKAASIFQWRVLGAGGTGPVPTTPSRTPSLSPASSLDV
Download sequence
Identical sequences W5Q1S5
ENSOARP00000016663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]