SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016775 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016775
Domain Number 1 Region: 245-568
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.77e-61
Family Glutamine synthetase catalytic domain 0.00081
Further Details:      
 
Domain Number 2 Region: 135-241
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.44e-19
Family Glutamine synthetase, N-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016775   Gene: ENSOARG00000015637   Transcript: ENSOART00000017013
Sequence length 571
Comment pep:known_by_projection chromosome:Oar_v3.1:2:111995915:112021524:1 gene:ENSOARG00000015637 transcript:ENSOART00000017013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKQSQNSIVQKHDTRDEDNETKASSMSKLMGTREKVTKLHISSTEVEEMDISNSKEKIET
SECATNKPVMVPGSPESHLTPDDKDSKDQTVVIKPLPLPTLINAPGGEFHPNSSDTDNTR
DNTRVSTAPQLSSRMKHIKQEMAKNHLQFVRFEATDLHGVSRSKSIPAQFFQEKVIHGVY
MPRGYLELIPNPKDNEVDHIRATCFNSDIVLMPELSTFRVLPWAKRTARVICDTFTVTGE
PLLTSPRHIAKRQLSQLQDAGFSLLSAFIYDFCIFGVPEIINSKTISLPASALLNNHDQP
FIQELVDGLYHTGANVESFSSSTRPGQMEICFLPEFGISSADNAFTLRMAVKEVARKYNY
ITSFFIETGFCNSGILSHSLWDVDEKKNMFCSSSGIEQLTIPGKKWLAGLLKHSAALSCL
MAPAVSCRKRYSKESKDLKESVPTTWGYNDNSCAFNVKCHGEKGTRIENKLGSATANPYL
VLAATIAAGLDGLCSDDGVLFGPENSTDLHQAKPSEIPLKLEHALMALEEDQCLRQALGE
TFIRYFVAMKKYELENEETDAERNKFLEYFI
Download sequence
Identical sequences W5Q237
ENSOARP00000016775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]