SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016951 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016951
Domain Number 1 Region: 27-229
Classification Level Classification E-value
Superfamily PHP domain-like 1.29e-43
Family RNase P subunit p30 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016951   Gene: ENSOARG00000015789   Transcript: ENSOART00000017192
Sequence length 268
Comment pep:known_by_projection chromosome:Oar_v3.1:22:12231111:12257200:1 gene:ENSOARG00000015789 transcript:ENSOART00000017192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVILFHLSKRVSEEVERVKSKRKKQQNMGYSVVAINHVVEFKEKKQEIEKPVAVSELFTT
LPIVQGKSKPIKILTRLTIIVSDPSHCNVLRATSSRVRLYDIVAVFPKTEKLFHVACTHL
DVDLVCITVTEKLPFYFKRPPINVAIDRGVGFELLYSPAIKDSTMRRYTISNALNLMQVC
KGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAVLLHGETRKTAFG
IISTVKKPRTSEADDDSLPACKKAKCES
Download sequence
Identical sequences W5Q2L3
ENSOARP00000016951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]