SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017124 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017124
Domain Number 1 Region: 46-178
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 2.15e-34
Family Methylmalonyl-CoA epimerase 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017124   Gene: ENSOARG00000015948   Transcript: ENSOART00000017365
Sequence length 179
Comment pep:known_by_projection chromosome:Oar_v3.1:18:26368061:26376138:-1 gene:ENSOARG00000015948 transcript:ENSOART00000017365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPKMARVLKVAAASAAGLFLRLRTPVSTVRTSASLSSHPGAGPVWNLGRLNHVAIAVPD
LEKARAFYKNVLGAEVGEPVPLPEHGVSVVFVNLGNTKMELLHPLGSDSPIAGFLKKNKA
GGMHHVCIEVDNINVAVMDLKEKKIRILSEEAKIGAHGKPVIFLHPGDCGGVLVELEQA
Download sequence
Identical sequences W5Q336
ENSOARP00000017124 XP_004017849.2.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]