SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017184 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017184
Domain Number 1 Region: 4-454
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 3.14e-115
Family 2-methylcitrate dehydratase PrpD 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017184   Gene: ENSOARG00000016003   Transcript: ENSOART00000017425
Sequence length 489
Comment pep:known_by_projection chromosome:Oar_v3.1:10:52549531:52556466:1 gene:ENSOARG00000016003 transcript:ENSOART00000017425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLKSVTESFAKVIHGLQVGHLTDRVIQRSKRMVLDALGVGLLGTSTEVFHKASGYSKIY
SSNVSSTVWGQPELRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLMALSEALP
PSPKYSGLDLLLAFNVGIEVQGRLLRFSKEACDIPKRFHPPSVVGTLGSAAAASKFFGLS
VTECQEALAIAVSHAGAPMANAATQTKPLHVGNAARHGLEAAFLAMLGLQGNKRILDSET
GFGAFYANYSPKVLPDLDSHTWLLEKQDVAFKRFPAHLATHWVADTAASVRRHLVTDKAP
LPIDRIERIVLRIPDVQYVNRPLPKSEHEARHSFQYVACVMLLDGVITVPAFHKRQIDRP
QVRELLGKVELEHPQDNLPNFNTLYCEMSVALKDGAVFTERSDTFYGHWRKPLSQKDLQE
KFRANSCRTLSCHAVERLIEIVENLEDLEDCSVLTTLLKETSPPKIASKSIQHLTVPSYN
LSYGLTTSK
Download sequence
Identical sequences W5Q396
XP_012040188.1.66739 ENSOARP00000017184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]