SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017411 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017411
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily FKBP-like 5.7e-43
Family FKBP immunophilin/proline isomerase 0.00000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017411   Gene: ENSOARG00000016219   Transcript: ENSOART00000017658
Sequence length 108
Comment pep:novel chromosome:Oar_v3.1:3:78777424:78777747:-1 gene:ENSOARG00000016219 transcript:ENSOART00000017658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVQVETISPGDGRTFPQHGQTCVVHYTGTLQDGKKFDSSRDRNKPFKFVLGKKQVIRGW
EEGIAQMSVGQRAKLTVSPDYAYGSRGHPGIIPPNATLIFDVELLKLE
Download sequence
Identical sequences W5Q3X2
ENSOARP00000017411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]