SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017467 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017467
Domain Number 1 Region: 103-154
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000327
Family VPS37 C-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017467   Gene: ENSOARG00000016264   Transcript: ENSOART00000017714
Sequence length 261
Comment pep:known_by_projection chromosome:Oar_v3.1:21:36662872:36668347:-1 gene:ENSOARG00000016264 transcript:ENSOART00000017714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGKMETLKDKTLEELKEMQNNPEAIDRLAQDSPEVQDLQLEREMALATNRSLAEQNLEFQ
GPLEISRSNLSDKYQELRKLVERCQEQKAKLEKFSSALQLGTLLDLLQIESMKIEEESEA
MAEKFLEGEVPLDTFLENFSSMRTLSHLRRVRVEKLQDVMRKPRASLEPAGDAPPPRPPP
PLRPGPQATPPPAEDTQPQPPPQPSVVPPYPLPYSPSPGMSVGPTAHGALPPAPFPVVPQ
PXQPPYPPGPAPPYGFPPPQG
Download sequence
Identical sequences W5Q428
ENSOARP00000017467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]