SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017518 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017518
Domain Number 1 Region: 676-711,860-1061
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000011
Family WD40-repeat 0.021
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000017518
Domain Number - Region: 413-466
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.000994
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017518   Gene: ENSOARG00000016304   Transcript: ENSOART00000017765
Sequence length 1096
Comment pep:known_by_projection chromosome:Oar_v3.1:24:1302802:1332808:1 gene:ENSOARG00000016304 transcript:ENSOART00000017765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQ
RHTEMIQTYVEHIERSKMQQVGGNSQTEGSLPGRSRKERPTSLSVFPLADGSVRAQMGGK
PAPAGDHWHLSDLGQLQLSSSYQCPQDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAV
TPLSESLQPLGEYGGSKNSKRAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIID
STPELDMGREPRLDRTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGN
TAIPGPAVGARLCLTSTLIATSGLRSARVSGDVFSQPRKGWGTPSVLCTSLWPFPPSSPR
SPDRVPLAADRKGRVKSEAITAHREPKEEVEDVSSCLCTELDKIPMAQRRRFTRVEMARV
LMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKR
SYPSVNIHYKSPTTAGFSQRRNHGMCQSAVGSRPLEFFPDEPEDCGGFPRREGEXTRQHP
AADGSRTPVSLPGLAPTARAALFLQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPTMKLWC
AAGVNLSGWKLSEDGPGNGVKPTPGRDPLTCDREVEGEAKSNHASPEKKKAKELPEADAT
SSRVWILTSSLTTSKVVVIDANQPGTVVDQFTVCNAHVLCISSIPAASDGDYPPGEIFLD
SDVNPEDTGTDGVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGEVSAVANGKVNPA
PSTEEATEATEVPDAGPSEAEAATVRPGPLTEHVFTDPAPTPPPSAQPDSENGPEADVSG
VQPEPEPSGDPAGSTSAAPTMWLGAQNGWLYVHSAVASWKKCLHSIKLKDSVLSLVHVKG
RVLVALADGTLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVHDRVWCGYKNKVHVI
QPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPY
VSKMLGTGKLGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQLLGLRGESK
VPTFVFRRPPSWAPWG
Download sequence
Identical sequences W5Q478
ENSOARP00000017518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]