SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017540 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017540
Domain Number 1 Region: 69-103
Classification Level Classification E-value
Superfamily LysM domain 0.0000876
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017540   Gene: ENSOARG00000016336   Transcript: ENSOART00000017788
Sequence length 306
Comment pep:known_by_projection chromosome:Oar_v3.1:5:87430362:87436358:-1 gene:ENSOARG00000016336 transcript:ENSOART00000017788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRHQNRSFPLPGIHSSAQVHGFGNCTDSDMLEEDAEVYELRSRGKEKIRRSTSKDRLD
DIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTET
LYPPKGRQASRPSTVQYLPEQQELLSANDSLSSTESAGSFLKEVDRDIEQIVKCTDTKRE
NLNEVVSALTAQQVRFEPDNKNIQRKDPYYGADWGIGWWTAVVIMLIVGIITPVFYLLYY
EILAKVDVSHHSTVDSSHLHSGVTPPSQQREMENGIAPTKGIPFGPQDDHKLYSQDSQLP
AAQHKT
Download sequence
Identical sequences W5Q4A0
XP_011975172.1.54773 XP_014951674.1.66739 ENSOARP00000017540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]