SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017748 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017748
Domain Number 1 Region: 1223-1361
Classification Level Classification E-value
Superfamily PRC-barrel domain 2.82e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0000016
Further Details:      
 
Domain Number 2 Region: 224-324
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000157
Family Calponin-homology domain, CH-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017748   Gene: ENSOARG00000016523   Transcript: ENSOART00000017999
Sequence length 1367
Comment pep:known_by_projection chromosome:Oar_v3.1:12:77483373:77578377:1 gene:ENSOARG00000016523 transcript:ENSOART00000017999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAADPRDGRRTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEELREPFYTD
QYDQEHIKPPVVGLLLSAELYCRAGSLILRSDAAKPLLGHDAVIQALAQKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSVEKVAACAQQYSAFFQATDLPYDIEDA
VTYWINKVNEHLKDIMEQEQKLKDHHAVETLGGQKARYRKEQTLLKQLPCIPLVENLLKD
GSDGCALAALIHFYCPGVVRLEDICLKETMSLADSLYNLQLIQEFCQEYLNQCCHFTLED
MLYAAASIKSNYLVFMAELFWWFEVVKPSFVQPRVAHPQGAEPVEDPPSVPVLNAAQEGA
LDSSDLMPGSGEGAAFAYSRPHLPSRHLQSQPPPSASGGIRRSSSMSYVDGFIGTWPKEK
RSSVHGVSFDISFDKENPVQRSTSNRGITRSLSNDGLALSNHRTARNARKNLAFKPVDGE
EHGVGSHGDLATYAPRSAGALNSNEKTHYRLPSGALPNSVLLDELGNQVGTPSIEEALQI
IHDTEKPVHTPRPDQLANGFFLHSQELSFLNAGVPRSQSSPENVGDTRGALSPVTDTTEV
DTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKFLQDYDVRTGSAREALSPCPSTV
STKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSSGSSSQKTTPEGSELNIPIEAQKK
KMEAAFTRQRQKMGRTAFLTVVKKKGDGVSPLREEAAGAGGGKXPPAPSAPGDPEGRWSP
AGPAEEPPQDGELLEHTRSIERLNASLHALQREMRRLALQQEALMHMREQQAWVISPPPP
PPHRPAREAPRPAHASPQAVPRKSASFSVKNQRTPRPSELKITPLHRTLTPPRSVDSLPR
LRRFSPSQVPIQTRSFVCLGDDGEPRAQESGRKDGAKEEEGSAGPPEHGEAQPPPSVAPE
GPAAPASEVTHPAPSEDPASQPAQLPSKPSVPPAAPKSANLIEVSLSDLKPPEKADVSVE
KYDGESDKEQADEDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRRERETQLRKQQLEA
EMEHKKEETRRRTEEERQKKEDERARREFIRQEYLRRKQLKLMEDMDAVLKPRPQVARQK
KQRPKSIHRDHLESPKTPVKGPPVSSLSLASLNMGDNESLHSGKRTPRSESVEGFLSPSR
CGSRNGEKDWENASTTSSVASGTEYTGPKLFKEPSAKSNKHIIQNALAHCCLAGKVNEGQ
KKKILEEMEKSDANNFLILFRDSGCQFRSLYAYCPDTEEISKLAGIGPKSVTKKMIEGLY
KYNSDRKQFSHIPAKTLSASVDAITIHSHLWQAKRPVTPKKLLPTKA
Download sequence
Identical sequences W5Q4V8
ENSOARP00000017748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]