SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017878 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017878
Domain Number 1 Region: 139-390
Classification Level Classification E-value
Superfamily vWA-like 9.89e-74
Family Integrin A (or I) domain 0.000000541
Further Details:      
 
Domain Number 2 Region: 368-480
Classification Level Classification E-value
Superfamily Integrin domains 9.42e-23
Family Integrin domains 0.0046
Further Details:      
 
Domain Number 3 Region: 644-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.000000000000628
Family Integrin beta tail domain 0.0074
Further Details:      
 
Domain Number 4 Region: 43-93
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000046
Family Plexin repeat 0.0029
Further Details:      
 
Domain Number 5 Region: 601-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Domain Number 6 Region: 560-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Integrin beta EGF-like domains 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000017878
Domain Number - Region: 531-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family Integrin beta EGF-like domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017878   Gene: ENSOARG00000016642   Transcript: ENSOART00000018129
Sequence length 798
Comment pep:novel chromosome:Oar_v3.1:3:133139887:133148491:1 gene:ENSOARG00000016642 transcript:ENSOART00000018129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSMVLVFLLALSRGESELDAKSSSPQEATEWRDPNLSRPGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCLXRQEMLQDDPLSQGTRGEGATRLAPQRV
RVTLRPGEPQQLRVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLVRNTRASPA
LSRPPPTLQESFGSFVDKTVLPFVSTVPSKLRHPCPSRLESCQSPFSFHHVLSLTGDAKA
FEREVGRQNVSGNLDSPEGGFDAILQAALCQKQIGWRNVSRLLVFTSDDTFHTAGDGKLG
GIFMPSDGHCHLDSNGLYSRSPEFDYPSVGQVAQALSAANIQPIFAVTSATLPVYRELSK
LIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHDSLLPPGVRISYESQCGDSEKRLG
EAADRGQCNHVRINQTVNFWVTFQATRCLPEPHLLRFRARGFSEELTVELHTLCDCNCSD
AQLQAPHCSDGQGHLQCGVCSCVPGRLGRLCECSEAELSSPDLESGCRAPNGTGPLCSGR
GQCQCGRCTCSGQSSGRLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DTDNCVSPDGGLCSGHGHCNCNRCQCNDGYYGALCDQCSGCKTPCETHRDCAECKAFGTG
PLAMNCSTACAHANTTLVLTPTLDDSWCKERTQDNQLFFFLAEDVAGGRVVLTVRPPEEG
ADHTQIIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREFHRFEKERQHLNWKQDHNPLYQS
AITTTVNPRFQEADSPLL
Download sequence
Identical sequences W5Q588
ENSOARP00000017878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]