SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017959 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017959
Domain Number 1 Region: 9-115
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0000000338
Family Spore coat polysaccharide biosynthesis protein SpsA 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017959   Gene: ENSOARG00000016720   Transcript: ENSOART00000018210
Sequence length 127
Comment pep:novel chromosome:Oar_v3.1:5:21799487:21802546:-1 gene:ENSOARG00000016720 transcript:ENSOART00000018210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMIKYMHDHYLDKYEWFMRADDDVYIKGDKLEEFLRSLNSSKPLYLGQTGLGNIEELGKL
GLEPGENFCMGGPGMIFSREVLRRMVPHIGECLREMYTTHEDVEVGRCVRRFGGTQCVWS
YEVRLEL
Download sequence
Identical sequences W5Q5G9
ENSOARP00000017959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]