SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000017969 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000017969
Domain Number 1 Region: 499-726
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.4e-58
Family Eukaryotic proteases 0.00000000528
Further Details:      
 
Domain Number 2 Region: 120-209
Classification Level Classification E-value
Superfamily Kringle-like 7.97e-35
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 3 Region: 210-294
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-33
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 4 Region: 303-388
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-32
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 5 Region: 394-481
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-28
Family Kringle modules 0.00042
Further Details:      
 
Domain Number 6 Region: 35-122
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.14e-20
Family Hairpin loop containing domain 0.0000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000017969   Gene: ENSOARG00000016727   Transcript: ENSOART00000018220
Sequence length 734
Comment pep:known chromosome:Oar_v3.1:4:38938624:39022690:1 gene:ENSOARG00000016727 transcript:ENSOART00000018220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVIRLLPVLLLQHVLLHLLLPIAIPYAEGQKKRRNTLHEFKKSAKTTLIKEDPLLKIKT
KKMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVKKEFGHEFDLYEN
KVDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTETGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAIAHSTMNDTDV
PMQTTECIQGQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPDNFKCKDLRENYCRNPD
GAESPWCFTTDPNIRVGYCSQIPKCDVSSGQGLDCYRGNGKNYMGSLSKTRSGLTCSMWD
KNMEDLHRHIFWEPDATKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPT
IVNLDHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCF
PSRNKDLKDYEAWLGIHDVHGRGDEKRKQVLNVTQLVYGPEGSDLVLLKLARPAILDDFV
STIDLPNYGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQYHQGKVTLNE
SEICAGAENIVSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAK
WIHKIILTYKAPQS
Download sequence
Identical sequences W5Q5H9
ENSOARP00000017969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]