SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018168 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018168
Domain Number 1 Region: 35-139
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 3.01e-41
Family Nucleoplasmin-like core domain 0.0000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018168   Gene: ENSOARG00000016916   Transcript: ENSOART00000018425
Sequence length 176
Comment pep:known_by_projection chromosome:Oar_v3.1:22:21696865:21698617:-1 gene:ENSOARG00000016916 transcript:ENSOART00000018425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADGAAALTFLDQESRVRAGGVGSLQVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDA
EHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPV
TFRLKSGSGPVRITGRHQIVTISNDLSGEESEEDGSEEEEAELCPILPAKKLGRRL
Download sequence
Identical sequences W5Q628
ENSOARP00000018168 XP_004020175.1.66739 XP_011975053.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]