SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018185 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018185
Domain Number 1 Region: 6-184
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.98e-46
Family YfcE-like 0.0000000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018185   Gene: ENSOARG00000016933   Transcript: ENSOART00000018443
Sequence length 186
Comment pep:known_by_projection chromosome:Oar_v3.1:17:53956053:53960785:-1 gene:ENSOARG00000016933 transcript:ENSOART00000018443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAGHRLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDV
HIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHT
HKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVER
IEYKKS
Download sequence
Identical sequences W5Q645
ENSOARP00000018185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]