SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018208 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018208
Domain Number 1 Region: 231-331,498-569
Classification Level Classification E-value
Superfamily TrmE connector domain 6.93e-41
Family TrmE connector domain 0.0027
Further Details:      
 
Domain Number 2 Region: 182-262,299-489
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.31e-34
Family G proteins 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018208   Gene: ENSOARG00000016953   Transcript: ENSOART00000018466
Sequence length 569
Comment pep:known_by_projection chromosome:Oar_v3.1:5:5526442:5529457:-1 gene:ENSOARG00000016953 transcript:ENSOART00000018466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLEEHYFTAPKRASPRLLSLSLASRSEDLQWMGSTSSKGPNDNRELLSTLPVTPRSGRD
LLQGLADPRGRVGRRIADCEPMWRGLWTLVSRAARGPHSPRLCTRQASGYPAPGSGATIF
ALSSGQGRCGIAVIRTSGPASGHALRSLTPPARKACLRLLSDPRSGEPLDRALVLWFPGP
QSFTGEDCAEFHVHGGPAVVSGVLQALGSVPGLRPAEAGEFTRRAFAHGKLSLTEVEGLA
DLIHSETEAQRRQALRQLDGELGDLCRGWAETLTKALAHVEAYIDFSEDDNLEEGVLDQA
DSEVRRLEVALGVHLRDARRGQRLRSGAHVVVAGPPNAGKSSLVNLLSRKPVSIVSPEPG
NTRDVLETPVDLAGFPALLSDTAGLREGVGPVEQEGVRRAQKRLEQADLILAVLDASDLA
SPASCNFLDTVVIPAGAGNPSGSHQRLLLVLNKSDLLPAGRSDPHPDLPSHLLLSCLTGE
GLDGLLEALKKELAALCGDPSTGPLLTRSRHQHHLQGCLDALGQYRQAKDLALAAEALRV
ARGHLSHLTGGGGTEEILDIIFRDFCVGK
Download sequence
Identical sequences W5Q668
ENSOARP00000018208 XP_012033100.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]