SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018294 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018294
Domain Number 1 Region: 6-132
Classification Level Classification E-value
Superfamily DNA clamp 0.00000000000000245
Family DNA polymerase processivity factor 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018294   Gene: ENSOARG00000017042   Transcript: ENSOART00000018555
Sequence length 429
Comment pep:known_by_projection chromosome:Oar_v3.1:17:53964307:53990181:1 gene:ENSOARG00000017042 transcript:ENSOART00000018555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLHFIISHTQSVVFGKAIQALSRISDELWLDPSEKGLALRSVNSCRSAYGCVLFSPVFFQ
HYQWSTSVKMNDTDKILNLNCRLGMKSILPIFRCLNSLEKNVEKCKIFTRSDKCKVVIQF
FCRHGIKKIHNVCFQESQPLQVIFQKNMCANTLVIQPRLLAEAIVLFTSSQEEVTLAVTP
LKVCIKSSNEESMDLTDSVYSEMFVGPDEFDFFQVGIDTEITFCFKELKGVLIFSEAIHA
PIAIHFDFPGKPMALSIDDMLLEANFILATLADEPSRASSLQTLCLSQKQKRSEPIHSNS
KAGKNVTSKVPEYISRKVEPKRLYSNETPTNSSTLENCGSPLMKRANDGDISEVPESNVS
DTEDVPGSPCLRKFSCMFFGAVSSDRQEPCSLPFQSLATASDSEEDMNNNLSVMQKRMEG
MPRNYFCIS
Download sequence
Identical sequences W5Q6F4
ENSOARP00000018294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]