SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018301 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018301
Domain Number 1 Region: 435-924
Classification Level Classification E-value
Superfamily ALDH-like 1.31e-160
Family ALDH-like 0.000000000745
Further Details:      
 
Domain Number 2 Region: 23-223
Classification Level Classification E-value
Superfamily Formyltransferase 4.84e-50
Family Formyltransferase 0.0000000219
Further Details:      
 
Domain Number 3 Region: 227-327
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.2e-25
Family Post formyltransferase domain 0.0000163
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000018301
Domain Number - Region: 346-418
Classification Level Classification E-value
Superfamily ACP-like 0.00329
Family Acyl-carrier protein (ACP) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018301   Gene: ENSOARG00000017047   Transcript: ENSOART00000018562
Sequence length 925
Comment pep:known_by_projection chromosome:Oar_v3.1:3:173626773:173689562:-1 gene:ENSOARG00000017047 transcript:ENSOART00000018562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWRGGQALRRFSTSRICFKNKLKVALIGQSLFGQEVYSHLCKEGHRVVGVFTVPDKDGK
ADPLALAAEKNGTPVFKFPRWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDVIDSP
KHGSIVYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQSEEGATYEGIQKKENAEISWNQSAE
ALHNWIRGHDKVPGAWAEINGQVVTFYGSSLLNSSVPPGEPLEIKGAEKPGLVTKNGLVL
FGNDGKALMVRNLQFEDGKMIPASQYFSSGEMSVVELTAEEMKVAETIKVIWAGILSNVP
AIEDSTDFFKSGARSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEDFIQKVVRKLRGED
QEAELVVDYVSKEINDMTVKMPYQCFINGQFTDAEDGKTYDTINPTDGSTICQVSYASLV
DVDKAVAAAKDAFENGEWGRMNARDRGRLMYRLADLMEEKQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGVVGQRLSE
HPDIRKLGFTGSTLIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELEKAVRMPKGMG
AVFFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEK
LLQYCEAGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFPN
GDIDGVLQRANNTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGFKQ
SGFGKDLGEEALNEYLKTKSVTLEY
Download sequence
Identical sequences W5Q6G1
ENSOARP00000018301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]