SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018557 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018557
Domain Number 1 Region: 9-132
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.15e-25
Family Ankyrin repeat 0.00077
Further Details:      
 
Domain Number 2 Region: 362-404
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000883
Family LEM domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018557   Gene: ENSOARG00000017289   Transcript: ENSOART00000018820
Sequence length 611
Comment pep:known_by_projection chromosome:Oar_v3.1:5:5566510:5570359:-1 gene:ENSOARG00000017289 transcript:ENSOART00000018820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPAVGLARRLRAALQEEELRTVEELLRRGADPNLVLEDGAAAMHLAARAQHLRSLCCLE
ALLRRGGDPNARSAEALTPLHVAAAWGCRRGLELLLSQGADPALRDQDGFLPLDLAEQQG
HQNCARVLRELETRTRIPARRTWKGSWKPEPEPEPGGPGPCEKGLDTSPSGPPNVMLNST
TLGTGDSKDVSLEAGPGPPGLLAHPETADTDGGLESPLGRWDCSSVTSFVTAVEASGAED
LTGHTSPWAGVRLSQRVPRSLGTLQLAHQPLLEDREAELNAHLQALTLTLPDESLSPKLF
PDRSPTHSPPWEPLPGPSDTHIPGEDQLSLDSDLAALWLTEDDASATVGRDPSPSDQCPP
DPPMSDLELLQGLRALGKSPGPITSFTRPHYLRRLKEAQAAPSPDFSGHSPELVEALRTG
RIPDAQADEDALAQQFERPDPTRRWREGVVKSSFTYLLLDPRKTQDLPARAFSLTLAECL
RIFVQAIFYVGKGTRARPDVHLWEALNHRRRPGKQACPKVRRILDIWATGRGVVSLHCFQ
HVVPAEAYTREACLVDALGIQMLTNQKQGHCYGVVADWPPTRRRRLGVHLLHRALLVFVA
EGERELRPQDI
Download sequence
Identical sequences W5Q765
ENSOARP00000018557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]