SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018676 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018676
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 8.37e-44
Family Nucleoplasmin-like core domain 0.00000387
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000018676
Domain Number - Region: 162-188
Classification Level Classification E-value
Superfamily ARM repeat 0.0095
Family GUN4-associated domain 0.076
Further Details:      
 
Domain Number - Region: 208-293
Classification Level Classification E-value
Superfamily HRDC-like 0.0111
Family RNA polymerase II subunit RBP4 (RpoF) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018676   Gene: ENSOARG00000017399   Transcript: ENSOART00000018939
Sequence length 305
Comment pep:novel chromosome:Oar_v3.1:1:160251504:160252442:1 gene:ENSOARG00000017399 transcript:ENSOART00000018939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSMDMDMSPLRPQNYLFGCELKADRDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEEEEEEEVKLLSISGKRSAPGSGSKVPQKKVKLAADEDEDDDDDDDDDDEEDDDD
DDFDEEVEEKAPVKKSVRDTPAKNAQKSNQNGKDSKPSTPRSKGQESFKKQEKTPKTPKG
PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSLLLKIFR
LISFL
Download sequence
Identical sequences W5QIQ4
ENSOARP00000018676 ENSOARP00000022606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]