SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018814 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018814
Domain Number 1 Region: 24-437
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 6.15e-100
Family Iron-containing alcohol dehydrogenase 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018814   Gene: ENSOARG00000017527   Transcript: ENSOART00000019080
Sequence length 442
Comment pep:known_by_projection chromosome:Oar_v3.1:9:43516867:43545070:1 gene:ENSOARG00000017527 transcript:ENSOART00000019080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTFALLAPGPSPSGKTTDYAFEMAVSTIRYGAGVTKEVGMDLQNMGAKNVCLMTDKNLS
HLPPVQTVMDSLVKNGINFKVYDHVRVEPTDTSFMEAIEFAKKGAFDAFLAVGGGSTIDT
CKAANLYSSSPDSDFLDYVNAPIGKGKPVTVPLKPLIAVPTTSGTGSETTGVAIFDYEHL
KVKTGIASRAIKPTLGLIDPLHTLHMPGRVVANSGFDVLCHALESYTALPYHMRSPCPSS
PITRPAYQGSNPISDIWAVHALRIVAKYLKRAVRNPDDLEARSNMHLASAFAGIGFGNAG
VHLCHGMSYPISGLVKTYKAKDYDVDHPLVPHGLSVVLTSPAVFTFTSQMFPERHLEVAE
ILGADTRTARRPDAGPVLADTLRKFLFDLDVDDGLAAIGYSKADIPELVKGTLPQERVTK
LAPRPQSEEDLSALFEASMKLY
Download sequence
Identical sequences W5Q7X2
XP_014953274.1.66739 ENSOARP00000018814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]