SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000018958 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000018958
Domain Number 1 Region: 155-284
Classification Level Classification E-value
Superfamily FKBP-like 1.18e-37
Family FKBP immunophilin/proline isomerase 0.0004
Further Details:      
 
Domain Number 2 Region: 47-163
Classification Level Classification E-value
Superfamily FKBP-like 1.81e-37
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 3 Region: 264-381
Classification Level Classification E-value
Superfamily FKBP-like 5.7e-37
Family FKBP immunophilin/proline isomerase 0.00026
Further Details:      
 
Domain Number 4 Region: 379-489
Classification Level Classification E-value
Superfamily FKBP-like 2.55e-31
Family FKBP immunophilin/proline isomerase 0.00042
Further Details:      
 
Domain Number 5 Region: 502-573
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000858
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000018958   Gene: ENSOARG00000017667   Transcript: ENSOART00000019226
Sequence length 587
Comment pep:known_by_projection chromosome:Oar_v3.1:11:41492182:41499959:1 gene:ENSOARG00000017667 transcript:ENSOART00000019226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHHSGPSAHSPLPAPKSPLLQLLLLLLLLQAGGRGLGRASPGGGPLEDVVIERYHIPRAC
PREVQMGDFVRYHYNGTFEDGKKFDSSYDRHTLAAIVVGVGRLITGMDRGLMGMCVNERR
RLIVPPHLGYGSIGVAGLIPPDATLYFDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDSD
FVRYHYNGTLLDGTAFDTSYSKGGTYDTYVGSGWLIKGMDLGLLGMCPGERRKIIIPPFL
AYGEKGYGTVIPSQASLVFHVLLIDVHNPKDTVQLETLELPPGCVRRAVAGDFMRYHYNG
SLMDGTLFDSSYSRNHTYNTYVGQGYIIPGMDQGLQGSCIGERRRITIPPHLAYGENGTG
DKIPGSAVLIFDVHVIDFHNPADPVEIKTLFRPLETCNETAKLGDFVRYHYNCSLLDGTR
LFSSHDYGAPQEATLGAHKVIEGLDTGLQGMCVGERRQVVVPPHLAHGESGARGVPGSAV
LLFEVELVSREDGLPTGYLFVWHEDPPANLFEHMDLNKDGEVPAEEFSTFIKAQVSEGKG
RLLPGQDPEKTIGDMFQNQDRNQDGKITADELKLKSDEDQERVHEEL
Download sequence
Identical sequences W5Q8B6
ENSOARP00000018958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]