SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019028 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019028
Domain Number 1 Region: 241-359
Classification Level Classification E-value
Superfamily ApaG-like 1.44e-36
Family ApaG-like 0.00037
Further Details:      
 
Domain Number 2 Region: 80-147,174-204
Classification Level Classification E-value
Superfamily YccV-like 0.00000000000876
Family YccV-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019028   Gene: ENSOARG00000017730   Transcript: ENSOART00000019296
Sequence length 372
Comment pep:known_by_projection chromosome:Oar_v3.1:11:19455193:19462654:-1 gene:ENSOARG00000017730 transcript:ENSOART00000019296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTLRSGDLEPRLPSACAGRSAKFAGRGREPRGRGNGAGQCGAGAERRPGAGLRHLSSRNR
PEGKVLETVGVFEVPKQNGKYETGQLFLHSVFGYRGVVLFPWQARLYDRDVASAAPEKAE
NPAGHGSKEVKGKTHTYYQVLIDARDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYV
SHEDILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKNHPWLELSDVHRE
TTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETV
RGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESN
KDEKTPPSGLHW
Download sequence
Identical sequences W5Q8I6
ENSOARP00000019028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]