SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019107 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019107
Domain Number 1 Region: 10-107
Classification Level Classification E-value
Superfamily FKBP-like 8.64e-37
Family FKBP immunophilin/proline isomerase 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019107   Gene: ENSOARG00000017806   Transcript: ENSOART00000019375
Sequence length 108
Comment pep:known_by_projection chromosome:Oar_v3.1:3:31595342:31601559:1 gene:ENSOARG00000017806 transcript:ENSOART00000019375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPGESKVVEPKERRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGF
EEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Download sequence
Identical sequences W5Q8R5
ENSOARP00000019107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]