SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019193 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019193
Domain Number 1 Region: 4-415
Classification Level Classification E-value
Superfamily ALDH-like 1.15e-122
Family ALDH-like 0.00000000000727
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019193   Gene: ENSOARG00000017886   Transcript: ENSOART00000019461
Sequence length 451
Comment pep:known_by_projection chromosome:Oar_v3.1:11:33426696:33432625:1 gene:ENSOARG00000017886 transcript:ENSOART00000019461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAISEVVQRARAAFNSGRTRPLQFRVQQLEGLRRLIREREKDLVGALAADLHKNEWTAY
YEEIVYVLEEIDYMIRKLPEWAADEPVEKTPHTQQDEAYIHSEPLGVVLIIGTWNYPFNL
TIQPMVGAIAAGNAVVLKPSELSENTASLLAAILPQYLDQDLYPVINGGVAETTEVLKER
FDHILYTGSTGVGRVVMMAAAKHLTPVTLELGGKNPCYVDKDCDLDIACRRIAWGKFMNS
GQTCAAPDYILCDPSIQSQIVEKLKKSLKEFYGEDAKKSRDYGRIINSQHFQRVMGLLEG
QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEVFGPALPIVCVRSLEEAIQLITQREK
PLALYVFSPNDKVIKKMIAETSSGGVTANDVVVHITVHSLPYGGVGIGPGGIGDQPGRAD
GRRGTGDSGTLLNEETLRARYPPSPAKMPRH
Download sequence
Identical sequences W5Q901
ENSOARP00000019193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]