SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019342 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019342
Domain Number 1 Region: 1038-1311
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-66
Family Protein kinases, catalytic subunit 0.0000369
Further Details:      
 
Domain Number 2 Region: 132-231
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000403
Family N-terminal PAS domain of Pas kinase 0.0000107
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000019342
Domain Number - Region: 346-392
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000803
Family Heme-binding PAS domain 0.036
Further Details:      
 
Domain Number - Region: 242-312
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00244
Family Heme-binding PAS domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019342   Gene: ENSOARG00000018016   Transcript: ENSOART00000019612
Sequence length 1347
Comment pep:known_by_projection chromosome:Oar_v3.1:1:552924:582608:1 gene:ENSOARG00000018016 transcript:ENSOART00000019612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGGSTASVEDHQGPGGSPSLPDPPEGPTAPAALEPGKSGSSAHRHVSRRTGLSKLCQS
RMALSEERWSSYCLSSLAAQNICTSKLHCSAAPGQADLTGSLGSTSCCSLLRALSSGWST
PLLPAPVCNPNKAVFTVDAKTTEILVANDRACRLLGHSSHDLIGQKLTQFFLKPDPDVVQ
ALSEEHVEADGHAAVAFGTVVDVVSRGGERIPVSVWMKRVKQERSLCCVVVLEPVERVSA
WVAFRSDGTVTSCDGLFAHLHGFASGEEVVGQHITDLIPSLQLPPPGEHVPTHLKIQRSV
GRARDGATFPVSLKLKSQPCSKEAADGEAAPSEGYSASVWVFSTISGLITLLPDGTIYGI
NHSFALMLFGYGRAELLGKNITFLIPGFYHQMDLAYDSSLPLRDLASCLDAGSRSGPGGS
ISEGNYDCVASDGIRCVSGLRCECVMSDRRESPCQMGCLSCLSRSAGAFPVSRRFSVVRG
LPSRATPAPVSKGGHRDPKASREPGHMPHGPRGLPAGAARSQVSPLSRSLILKNHFETEL
LKKNGGSRSPPECPRDVPEGGPSARSGPSSPEGQQRSVSEQEQPATAEHLSRDLQRGSQF
ELGDTKLSASQEDSEAAIPGADRSSGDETHGPCQEAWAERGSASDSDQGPDVATAVSHTE
GCLAGQGPQGEQSALPGSPCLAASPPGTLQLLFSTPPLDEPWLEARQDREELHTCLIKEQ
LSASSRAGPWGVSYAELVLMGQPPLSAPASLLDLRATEHGAVCLALATDLPGALEAVEVP
EASENSFSWNLKELVFRDWTDRTSSNCSCATSELGGTPSPSLVGSDADVGALHRQRSDVL
DDRELLLLTGTCVDLCGGRRFRESRLGLEETEPSQTCLVSSEHQDVNGCDSPSRVLPVLA
AGPEDECPLEAPGLSLHVTSTPVRAEGPGPAPLRAADLQPGIPCGISMYRAGWHLCVQFE
VRRVELQGPATLFCCWLVKDLLRTHLLLASLPSSAHSTCELPAASLGEVLGTRPWFEEPP
KAVEPEGLAACEGAYSLKYSTLSPIGSGAFGFVWTAVDKEANKEVVVKFIKKEKVLEDCW
IEDPKLGKVTLEIAILCKVEHANIIKVLDVFENQGFFQLVMEKHGSGLDLFAFIDRHPSL
DEPLASYIFRQLVAAVVYLRSESILHRDIKDENIVIAEDFSIKLIDFGSAAYLERGKLFY
TFCGTIEYCAPEVLMGNPYRGPELEMWSMGVTLYTLIFEENPFCELEETMEAAINPPYLV
SEDLMNLMSGLLQPVPEQRTTLEELVTDPWVTQPVNLADYTWEEVCRLNKSDSRALSTVG
LELDAAARAPEPHRPSCSRAGPRAPAD
Download sequence
Identical sequences W5Q9F0
ENSOARP00000019342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]