SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019362 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019362
Domain Number 1 Region: 423-621
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-69
Family Hemopexin-like domain 0.00000000216
Further Details:      
 
Domain Number 2 Region: 50-179,352-407
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.74e-37
Family Matrix metalloproteases, catalytic domain 0.000000384
Further Details:      
 
Domain Number 3 Region: 238-295
Classification Level Classification E-value
Superfamily Kringle-like 2.11e-21
Family Fibronectin type II module 0.0000554
Further Details:      
 
Domain Number 4 Region: 298-354
Classification Level Classification E-value
Superfamily Kringle-like 2.54e-21
Family Fibronectin type II module 0.000076
Further Details:      
 
Domain Number 5 Region: 182-237
Classification Level Classification E-value
Superfamily Kringle-like 3.71e-20
Family Fibronectin type II module 0.000063
Further Details:      
 
Domain Number 6 Region: 5-68
Classification Level Classification E-value
Superfamily PGBD-like 5.65e-19
Family MMP N-terminal domain 0.0000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019362   Gene: ENSOARG00000018035   Transcript: ENSOART00000019632
Sequence length 621
Comment pep:known chromosome:Oar_v3.1:14:23241326:23267541:1 gene:ENSOARG00000018035 transcript:ENSOART00000019632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGELDQSTIETMRK
PRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPQTVDDAFARAFQVWSDVTPLRF
SRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELWTLGEGQ
VVRVKYGNADGEYCKFPFRFNGKEYTSCTDTGRSDGFLWCSTTYNFDKDGKYGFCPHEAL
FTMGGNADGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMST
VGGNSEGAPCVFPFTFLGNKHESCTSAGRSDGKLWCATTSNYDDDRKWGFCPDQGYSLFL
VAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSHDDIQGIQELYGASPDIDTGTGPTP
TLGPVTPELCKQDIVFDGISQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEK
IDAVYEDPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQKVDAAFNWSKNKK
TYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLK
LENQSLKSVKFGSIKSDWLGC
Download sequence
Identical sequences W5Q9H0
ENSOARP00000019362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]