SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019410 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019410
Domain Number 1 Region: 2-429
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-130
Family ALDH-like 0.0000000000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019410   Gene: ENSOARG00000018083   Transcript: ENSOART00000019680
Sequence length 485
Comment pep:novel chromosome:Oar_v3.1:11:33465857:33479627:-1 gene:ENSOARG00000018083 transcript:ENSOART00000019680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEREVQRVRAAFGSGRSRPLTFRRRQLEALRAMVQEREKDILAAIGADLSKSEFNAYSQE
VISVLGEIDLMLEKLPEWAAAKPAQRNLLTMLDEAYIQPEPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSEVSENTAKLLAKLLPQYLDQDLYAVVNGGVEETTELLKQRFDH
ILYTGNTAVGKIVMQAAAKHLTPVTLELGGKSPCFVDRDCDLDVACRRIAWGKFMNCGQT
CIAPDYVLCEPSLQDQIVRKVQEAVKEFYGENVKESPDYERIVNLRHFKRIQSLLEGQKI
AFGGEMDEATRYIAPTVLTDVDPDTKVMQEEIFGPILPIVPVKNADEAIQFINEREKPLA
FYVFSHNSKLIKRMIDGTSSGGVTGNDVIMHFMLSSLPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKTLKREGANQLRYPPNSQSKVDWAKFFLLKRFNKGKLGLLLLTLLGVLAAVLI
KGGYY
Download sequence
Identical sequences W5Q9L8
XP_004012777.1.66739 XP_012009833.1.54773 ENSOARP00000019410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]