SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019652 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019652
Domain Number 1 Region: 33-550
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 7.85e-163
Family Aconitase iron-sulfur domain 0.00000000000000339
Further Details:      
 
Domain Number 2 Region: 557-776
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 4.32e-65
Family LeuD-like 0.00000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019652   Gene: ENSOARG00000018307   Transcript: ENSOART00000019925
Sequence length 783
Comment pep:known_by_projection chromosome:Oar_v3.1:3:216599148:216619489:1 gene:ENSOARG00000018307 transcript:ENSOART00000019925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NTLLTVTVVFLQKALGARQYHVASVLCQRAKVAMSHFEPNEYIRYDLLEKNINIVRKRLN
RPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPRVAV
PSTIHCDHLIEAQLGGEKDLAGCHDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILEN
YAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSG
WTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYN
HRMKKYLSKTGRADIANLADEFKDHLVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHP
VAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLQCKSQFTITPGS
EQIRATGGAGALAQILRDVGGVVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRN
DANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPRAEFDPG
QDTYQHPPKDSSGQQVDVSPTSQRLQLLEPFDKWDGRDLEDLQILIKVKGKCTTDHISAA
GPWLKFRGHLDNISNNLLIGAINVENGKANSVRNAITQEFGPVPDTARYYKKHGIRWVVI
GDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHP
VDKLTIKGLKDFAPGKPLTCIIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQN
QSQ
Download sequence
Identical sequences W5QAA9
ENSOARP00000019652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]