SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019693 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019693
Domain Number 1 Region: 51-527
Classification Level Classification E-value
Superfamily ALDH-like 5.37e-136
Family ALDH-like 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019693   Gene: ENSOARG00000018344   Transcript: ENSOART00000019966
Sequence length 539
Comment pep:known_by_projection chromosome:Oar_v3.1:5:24781254:24819505:1 gene:ENSOARG00000018344 transcript:ENSOART00000019966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRVPGLLCVRVARKSKFSGPWTRPAAFMSTLLINQPQYAWLKELGLREENDGVYNGSWG
GRGEVITTYCPANNEPIARVRQASMADYEETVEKAREAWSIWADIPAPKRGEIVRQIGDA
LREKIQVLGSLVSLEMGKILVEGVGEVQEYVDVCDYAVGLSRMIGGPILPSERPGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNACLWKGAPTTSLISVAVTKIIAKVLED
NKLPGAICSLTCGGADVGTAMAKDERVDLLSFTGSTQVGKQVALMVQERFGRSLLELGGN
NAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFLHESIHDEVVNRLKKAYAQIRVG
NPWDSNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLEHD
ASIVHTETFAPILYVFKFKNEDEVFAWNNEVKQGLSSSIFTKDMGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
Download sequence
Identical sequences W5QAE8
ENSOARP00000019693 XP_004008714.1.66739 XP_011985512.1.54773 XP_012033589.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]