SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019811 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019811
Domain Number 1 Region: 1706-2009
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000301
Further Details:      
 
Domain Number 2 Region: 37-300
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.97e-75
Family Carbonic anhydrase 0.0000075
Further Details:      
 
Domain Number 3 Region: 2025-2295
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.56e-71
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000177
Further Details:      
 
Domain Number 4 Region: 309-409
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000856
Family Fibronectin type III 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019811   Gene: ENSOARG00000018446   Transcript: ENSOART00000020084
Sequence length 2325
Comment pep:known_by_projection chromosome:Oar_v3.1:4:86318331:86517588:1 gene:ENSOARG00000018446 transcript:ENSOART00000020084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLILKRFLACVQLLCVCRLDWIYGYYRQQRKLVEEIGWSYTGALNQKNWGKKYPTCNSPK
QSPINIDEDLTQVNVNLKKLKFQDWDKTSLENTFIHNTGKTVEINLTNDYRLSGGVSETV
FKASKIAFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAIKGKGKLRALS
ILFEVGIEENLDYKAIIDGVERVSRFGKQAALDPFTLLNLLPNSTDKYYTYNGSLTSPPC
TDTVDWIIFKETVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
TGKEEIHEAVCSSEPENVQADPENYTSLLVTWERPRVVYDTMIEKFAVLYQQLEGEDQTK
HEFLTDGYQDLGAILNNLLPNMSYVLQIVAICANGLYGKYSDQLIVDMPSDDPELDLFPE
LIGTEEIIKEEEEGKDMEGDTVVNPGRDGATNQIRRKEPQIPTTTNYNRVGTKYNEAKTN
RSPARGSEFTGKSDIPNTPLDSTSQPVPELDPEKDVPSTSQTVTQPPPLTLAGTSASSSD
GSKTILRFPQMNLSGTVEYSDTVSTTESQEVSTDISEEESLLTSFKLDPGADDSSGSSPA
TSAVPLVSENTPHGDVFPSENPEVVTYDVFIPESARNASEDSASSGSEESLKDPSVDGNV
WFPSTTDVTTLPEVGSGREHLLQTNYTDVDSDESEKTTESSPPGPLLSQGPSVSDVRMPQ
YSTFAYFPTEVTPHAFTPSSGQHHSVPTINVVHAQTTQPVYNGEAPLQPSYSSEVFPLVT
PLLLDNQTLNTTPAASSSDWALHATPVFPSVGVSFESILSSYDGAPLLPFSSASSSSELL
RRVYTISQILPQVTAALESDQGSLHVSLPVAGGDLLLEPSLAPYSDAMPHQITTRAASET
LEFGASKPAVLYQTLVFSPAEASSSDVLMHARSSGPEPSYALTNEEGSQHLFRVSDSSAV
PGRDSVQGSLSSSPSHHLPMPESPLVTPSASLLQPNQGLSGDGEWSGASSDSEFFVPDTD
GLTALNMSSPISVAEFTYPTSMSGDDNKLLSKSDRIYGEETERHISSFSDLVYPSESTVM
PDLYNRVNTLNASLQESSASTSSPEGVLSELPAFTATKVYDHEISQIPENNFLVQSSHAV
SQAFGDTSLKPALSAHSEPASSDPTSSEMLSPSTQLLVYEPSASFNTEVLLQPSFQVSGV
DLLLKTALPAVPSDPIVVETPKVDHIRSTVPHLMASNAASRENTLHSPSVPISDVSPTPN
THAASLQVLTISYASEKYSEPLLHKSESYHQTVPSLYSNDELFQTASLELNQAFPPEGRH
SYATPVLSVAPPDTLINKLVYSDEVFTSTKGPVTDEVLAGIPTVVSDPVVTADPSVPLGN
VYVSISAISPNKDGSVTTTNLLFPSRTTSEPIQSARSDASLVGGGDDGDIDDYGDDDYDD
RDKDGLSINRCMSCFSYRESQEKVMNDSDTQQNSSVDQNNAISYALSQNSEEGNKITGVI
SDDQTDMERSPDKSPPTNVPPQKRNDGKQENNVQTHNALLPFSPESKAWAVLTSDEESGS
GQGASDSLNDNETSTDFSFPDINEKDGDGVLETGDSEITPGSPQSSTPTITSRHSEVFNI
SETTEASNSSHESRIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAH
FYLEDSTSPRVISTPPTPIFPISDDVGAIPIKHFPKHVADLHASSGFTEEFETLKEFYQE
VQSCTVDLGITADSSNHPDNKHKNRYINIVAYDHSRVKLTQLAEKDGKLTDYINANYVDG
YNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPVDGSEEYG
NFLVTQKSIQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYSLP
VLTFVRKASHAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNVFGFLKHIRS
QRNYLVQTEEQYVFIHDALVEAILSKETEVPDSHIHAYVNGLLIPGPTGKTKLEKQFKLL
SQSNIQQSDYSTALKQCNREKNRTSSIIPVERSRVGISSLSGEGADYINASYIMGYYQSN
EFIITQHPLLHTIKDFWRMIWDHNAQLVVMLPDGQNMAEDEFVYWPNKDEPINCESFKVT
LMAEEHKCLSNEEKLIMQDFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISIIKE
EAATRDGPMIVHDEHGGVTAGTFCALTTLMHQLEKENSMDVYQVAKMINLMRPGVFADIE
QYQFLYKAVLSLVSTRQEENPSTSLDSNGAALADGNIAESLESLV
Download sequence
Identical sequences W5QAR6
ENSOARP00000019811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]