SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000019836 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000019836
Domain Number 1 Region: 12-213
Classification Level Classification E-value
Superfamily Heme oxygenase-like 2.23e-68
Family Eukaryotic type heme oxygenase 0.000000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000019836   Gene: ENSOARG00000018475   Transcript: ENSOART00000020109
Sequence length 271
Comment pep:known_by_projection chromosome:Oar_v3.1:3:178680119:178684272:1 gene:ENSOARG00000018475 transcript:ENSOART00000020109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERQQPDSMPQDLSEALKEATKEVHTQAENAEFMKNFQKGELTREGFKLVMASLYHIYVA
LEEEIERNKENPVYTPLYFPEELHRRAALEQDMAFWYGPRWQEAIPYTQATKRYVQRLQE
VGRAEPELLVAHAYTRYLGDLSGGQVLKKIAQKALNLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNTLEMTPEVRQRVLDEAKTAFLLNIQVRVWAVLRGHPASSCSSRDISRRVGGGG
RQRSWLRAGAWGPGFQFCHLPGGVILGKSLS
Download sequence
Identical sequences W5QAU1
ENSOARP00000019836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]