SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020145 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020145
Domain Number 1 Region: 110-362
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.37e-79
Family Glutamine synthetase catalytic domain 0.0018
Further Details:      
 
Domain Number 2 Region: 19-109
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.7e-20
Family Glutamine synthetase, N-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020145   Gene: ENSOARG00000018757   Transcript: ENSOART00000020424
Sequence length 373
Comment pep:known_by_projection chromosome:Oar_v3.1:12:61575579:61582005:-1 gene:ENSOARG00000018757 transcript:ENSOART00000020424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSASSHLNKGIKQVYMALPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCIEELPEW
NFDGSSTFQSEGSNSDMYLVPAAMFRDPFRKDPNKLVFCEVFKYNRKPAETNLRHTCKRI
MDMVSNQRPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY
RACLYAGIKIGGTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDP
KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL
TGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPFAVTEALIRTCL
LNETGDEPFQYKN
Download sequence
Identical sequences Q6TEP3 W5QBP6
ENSOARP00000020143 ENSOARP00000020145 XP_004013897.1.66739 XP_005963491.1.78601 XP_005963492.1.78601 XP_017916175.1.57651 XP_017916176.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]