SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020281 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020281
Domain Number 1 Region: 623-1143
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.4e-147
Family alpha-mannosidase, C-terminal domain 0.00000226
Further Details:      
 
Domain Number 2 Region: 125-500
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.88e-144
Family alpha-mannosidase 0.00000000207
Further Details:      
 
Domain Number 3 Region: 503-615
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 1.11e-29
Family alpha-mannosidase, domain 2 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020281   Gene: ENSOARG00000018880   Transcript: ENSOART00000020561
Sequence length 1144
Comment pep:known_by_projection chromosome:Oar_v3.1:5:105984860:106179347:1 gene:ENSOARG00000018880 transcript:ENSOART00000020561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPKSPRREGSFPQGQLSMLQEKIDHLER
LLAENNEIISNIRDSVINLSESVEDGTKNSKGNFSHGAGSPLLPAKHPSLAVDPGDCLFA
SQSGSHSPDVQMLDVYSLIPFDNPDGGVWKQGFDITYKPDEWDTKPLQVFVVPHSHNDPG
WLKTFDDYFREKTQYIFNNMVVKLKEDPRRKFIWSEISYLSKWWETIDVQKKDAVKSLLE
NGQFEIVTGGWVMPDEAGAHYFAIIDQLIEGHQWLETNLGVKPRSGWAIDPFGHSPTMAY
LLKRAGFSHMLIQRVHYAVKKHFALHKTLEFFWRQNWDLGSATDILCHMMPFYSYDIPHT
CGPDPKICCQFDFKRLPGGRYGCPWGVPPETIYPGNLQNRAEMLLDQYRKKSKLFRTTVV
LAPLGDDFRYTERTEWDHQFKNYQLLFDYMNSHPQYNVKIQFGTLSDYFDALEKEASANT
RNSQSIFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRTLESHLRAAEILYYFALKQA
KQYKISKFLSSSHYVMLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMNLKKVI
GHSALLLILKDKHLYDSYSSDTFLEMDLKQRTQSSLPQKHVISLSAEPRYLVVYNPLEQA
RSSVVSVCVSSPAAQVSSASGEPVEIQMSAVWDTANTASQTVYEISFLAEMPPLGLKVYK
ILETSSSSPHLAKYDLYNGNIANEGIFNMNNIKSAQEAITLENSFIKLRFGQSGLLEEMI
NKGDGKSLEVRVQFSWYGTTSKKDKSGAYLFLPDGEAKPYVYTTPPFVRVQRGRFYSDVT
CFFEHVTHRVRLYNIHGVEGQSVEISNIVDIRKEHNYEIAMRISSGINSQNRFYTDLNGY
QIQPRVTMSKLPLQANVYPMTTMAYIQDAERRLTLLSAQSLGVSSLKSGQIEVIMDRRLM
QDDNRGLEQGVHDNKITANLFRILLEERSVNMEEDQKAVSYPSLLSHITSSFLNHPVFPM
TEKAPVPALQLLGGFSPLMSPLPCDIHLVNLRTVQSKVDGKHSSEAALILHRKGFDCRFS
SRDPGLLCSTTQGKILVQKLFSTFTVVSIIPSSLSLMHSPPDARNISEINLSPMEISAFR
IRLR
Download sequence
Identical sequences W5QC34
XP_004009160.1.66739 ENSOARP00000020281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]