SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020543 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020543
Domain Number 1 Region: 66-185,261-366
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 9.16e-64
Family FabD-like 0.0001
Further Details:      
 
Domain Number 2 Region: 194-268
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000106
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020543   Gene: ENSOARG00000019125   Transcript: ENSOART00000020826
Sequence length 392
Comment pep:known_by_projection chromosome:Oar_v3.1:3:217935946:217950686:-1 gene:ENSOARG00000019125 transcript:ENSOART00000020826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRVARAARAWARSVSGRRGSSNCPRPPPAAVDVAALLREATAADGGSRDAEVAAGRRE
PGQCSVLLFPGQGSQMVGMGRGLLRYPRVRELYDAARRVLGYDLLELSLRGPREALDRTV
HCQPAVFVASLAAVEKLHHLQPAVIENCVAAAGFSVGEFAALVFAGAMEFSEGLYAVKIR
AEAMQEASEAVPSGMLSVLGQRQSKFAVACLEAQEHCKTQGIEDPVCEVANYLFPDCRVI
SGHLEALQFLQKNSSKYHFRRTKMLPVSGGFHTRLMEPAVEPLAQVLKAIDVKKPLVSVH
SNVDGNRYMHPKHIQKLLAQQVVSPVKWEQTMHAIYERRKGTAFPQTFEVGPGKQLGAIL
KSCNLQAWRSYSHVEVLEASEDTEGPLPLPPR
Download sequence
Identical sequences W5QCU5
ENSOARP00000020543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]