SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020586 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020586
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily Globin-like 4.28e-52
Family Globins 0.000000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020586   Gene: ENSOARG00000019163   Transcript: ENSOART00000020869
Sequence length 146
Comment pep:known chromosome:Oar_v3.1:15:47565510:47567511:1 gene:ENSOARG00000019163 transcript:ENSOART00000020869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMLTAEEKAAVTGFWGKVKVDEVGAEALGRLLVVYPWTQRFFEHFGDLSNADAVMNNPKV
KAHGKKVLDSFSNGMKHLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVVVLARHHGN
EFTPVLQADFQKVVAGVANALAHKYH
Download sequence
Identical sequences W5QCY8
ENSOARP00000020586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]