SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020766 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020766
Domain Number 1 Region: 1541-1715
Classification Level Classification E-value
Superfamily Fibronectin type III 4.56e-29
Family Fibronectin type III 0.0000485
Further Details:      
 
Domain Number 2 Region: 1907-2074
Classification Level Classification E-value
Superfamily Fibronectin type III 1.77e-27
Family Fibronectin type III 0.00000981
Further Details:      
 
Domain Number 3 Region: 909-1078
Classification Level Classification E-value
Superfamily Fibronectin type III 1.32e-25
Family Fibronectin type III 0.00062
Further Details:      
 
Domain Number 4 Region: 727-892
Classification Level Classification E-value
Superfamily Fibronectin type III 3.51e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 5 Region: 1266-1439
Classification Level Classification E-value
Superfamily Fibronectin type III 6.53e-22
Family Fibronectin type III 0.0000106
Further Details:      
 
Domain Number 6 Region: 409-464
Classification Level Classification E-value
Superfamily Kringle-like 6.57e-21
Family Fibronectin type II module 0.0000527
Further Details:      
 
Domain Number 7 Region: 1726-1896
Classification Level Classification E-value
Superfamily Fibronectin type III 7.86e-21
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 8 Region: 349-404
Classification Level Classification E-value
Superfamily Kringle-like 1.63e-20
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 9 Region: 1448-1538
Classification Level Classification E-value
Superfamily Fibronectin type III 4.19e-20
Family Fibronectin type III 0.00000573
Further Details:      
 
Domain Number 10 Region: 1174-1262
Classification Level Classification E-value
Superfamily Fibronectin type III 4.52e-17
Family Fibronectin type III 0.0000028
Further Details:      
 
Domain Number 11 Region: 558-604
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000994
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 12 Region: 2341-2384
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000017
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 13 Region: 516-560
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000301
Family Fibronectin type I module 0.0045
Further Details:      
 
Domain Number 14 Region: 619-701
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000328
Family Fibronectin type III 0.00000576
Further Details:      
 
Domain Number 15 Region: 231-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000118
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 16 Region: 473-512
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000017
Family Fibronectin type I module 0.0019
Further Details:      
 
Domain Number 17 Region: 94-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000288
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 18 Region: 2296-2339
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000602
Family Fibronectin type I module 0.0034
Further Details:      
 
Domain Number 19 Region: 185-230
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000864
Family Fibronectin type I module 0.00016
Further Details:      
 
Domain Number 20 Region: 50-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000017
Family Fibronectin type I module 0.00019
Further Details:      
 
Domain Number 21 Region: 142-182
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000353
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 22 Region: 2384-2425
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 23 Region: 307-345
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000012
Family Fibronectin type I module 0.0003
Further Details:      
 
Domain Number 24 Region: 2210-2273
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000289
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 25 Region: 1095-1181
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000056
Family Fibronectin type III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020766   Gene: ENSOARG00000019329   Transcript: ENSOART00000021052
Sequence length 2478
Comment pep:known_by_projection chromosome:Oar_v3.1:2:216309354:216378137:-1 gene:ENSOARG00000019329 transcript:ENSOART00000021052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGGPGPGLLLLLAVLSLGTAVPSAGASKSRRQAQQIVQPQSPLTVSQSKPGCYDNGKHY
QINQQWERTYLGSALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTC
KPIAEKCFDQAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTS
YRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSLQTTSAGSGSFTDIRPAIYQPQPH
PQPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAITQTYGGNSNGEP
CVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGAL
CHFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYR
IGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDGITYNVNDTFHKRHEEGH
MLNCTCFGQGRGRWKCDPVDQCQDSETRTFYQIGDSWEKYLQGVRYQCYCYGRGIGEWAC
QPLQTYPDASGPVQVIITETPSQPNSHPIQWNAPESSHISKYILRWKPKNSPNRWKEATI
PGHLNSYTIKGLRPGVVYEGQLISVQHYGQREVTRFDFTTTSTSPAVTSNTVTGETTPLT
PVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPD
LLPGRKYTVNVYEISEEGEQNLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPRAPIT
GYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETT
GVPRSDKVPPPRDLQFVEVTDVKITIMWTPPESPVTGYRVDVIPVNLPGEHGQRLPVSRN
TFAEVTGLSPGVTYHFKVFAVNQGRESKPLTAQQATKLDAPTNLQFINETDTTVIVTWTP
PRARIVGYRLTVGLTRGGQPKQYNVGPAASQYPLRNLQPGSEYAVSLVAVKGNQQSPRVT
GVFTTLQPLGSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSESGSIV
VSGLTPGVEYVYTISVLRDGQERDAPIVKKVVTPLSPPTNLHLEANPDTGVLTVSWERST
TPDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFENLSPGLEYNVSVYTVKDDKESVPI
SDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSS
VGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNVGPDTMRVTWA
PPSSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESI
PLRGRQKTALDSPSGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHMGGRPREDRVPP
SRNSITLTNLNPGTEYVVSIVALNSKEESQPLVGQQSTVSDVPRDLEVIAATPTSLLISW
DAPAVTVRYYRITYGETGGSSPVQDFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSP
ASSKPVSINYRTEIDKPSQMQVTDVQDNSISVRWLPSSSPVTGYRVTTAPKNGPGPSKTK
TVGPDQTEMTIEGLQPTVEYVVSVYAQNQNGESQPLVQTAVTNIDRPKGLAFTDVDVNSI
KIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEETAELQGLRPGSEYTVSVVALHDD
MESQPLIGTQSTAIPAPTNLKFTQVTPTSLTAQWTAPNVQLTGYRVRVTPKEKTGPMKEI
NLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVITTLENISPPRRARVTDATET
TITISWRTKTETITGFQVDAIPANGQTPIQRTIRPDVRSYTITGLQPGTDYKIHLYTLND
NARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVV
PRPRPGVTEATITGLEPGTEYTIQVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGP
EILDVPSTVQKTPFITNPGYDTGNGIQLPGTSGQQPSLGQQMIFEEHGFRRTTPPTTATP
VRHRPRPYPPNVNEEIQIGHVPRGDVDHHLYPHAVGLNPNASTGQEALSQTTISWTPFQE
SSEYIISCHPVGVDEEPLQFRVPGTSASATLTGLTRGATYNIIVEAVKDQQRQKVREEVV
TVGNSVDQGLSQPTDDSCFDPYTVSHYAVGEEWERLSDSGFKLSCQCLGFGSGHFRCDSS
KWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQW
QKEYLGAICSCTCFGGQRGWRCDNCRRPGAEPGNEGSTAHSYNQYSQRYHQRTNTNVNCP
IECFMPLDVQADTEDSRE
Download sequence
Identical sequences W5QDG8
XP_004004956.1.66739 ENSOARP00000020766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]