SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000020847 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000020847
Domain Number 1 Region: 10-81
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 2.69e-29
Family Ribosomal protein L37ae 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000020847   Gene: ENSOARG00000019405   Transcript: ENSOART00000021133
Sequence length 92
Comment pep:novel chromosome:Oar_v3.1:2:217474560:217477048:1 gene:ENSOARG00000019405 transcript:ENSOART00000021133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFYFETKMKRRAVGIWHCGSC
MKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ
Download sequence
Identical sequences W5QDP9
ENSOARP00000020847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]