SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000021230 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000021230
Domain Number 1 Region: 5-353
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.35e-75
Family ADP-ribosylglycohydrolase 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000021230   Gene: ENSOARG00000019768   Transcript: ENSOART00000021525
Sequence length 364
Comment pep:known_by_projection chromosome:Oar_v3.1:1:182651580:182655255:1 gene:ENSOARG00000019768 transcript:ENSOART00000021525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGALMERYVAAMVLSAAGDALGYFNGKWEFLRNGEKIHRQLAQLGGLDAIDVERWRVSD
DTVMHLATAEALLEAGKVSDLTHLYSLLAKHYQDCMGDMDGRAPGGASVQNAMLLKPDKA
NGWRIRFNSHEGGCGAAMRAMCIGLRFPHSSQLDTLIQVSIESGRMTHHHPTGYLGALVS
ALFTAYAVNGKPPQQWGRGLMEVLPEAKKYIVQSGYFVEQNLQHWSYFQDQWEKYLKLRG
IWDGKSAPTFPKPFDVKERDQFYTSVSYSGWGGSSGHDAPMIAYDAILAAGDSWKELAHR
AFFHGGDSDSTAAIAGCWWGAMYGFKGVSPSNYEKLEYRNRLQETARALYSLSSLVSKSR
VLTL
Download sequence
Identical sequences W5QET2
ENSOARP00000021230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]